PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han002034
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family NAC
Protein Properties Length: 274aa    MW: 31465.2 Da    PI: 6.6758
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-169a-Helianthus_annuus-34497PU_refplantGDBView CDS
gnl|UG|Han#S32089308PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.73.9e-5281321128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtd+elv++yL++k++++++++  +i+e+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   + v
  Han002034   8 LPPGFRFHPTDDELVMHYLCRKCASQPISV-PIIAEIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKPV 104
                79****************************.88***************7666789*************************************98..789* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+ap+g+kt+W+mheyrl
  Han002034 105 GIKKALVFYAGKAPRGVKTNWIMHEYRL 132
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.19E-624159IPR003441NAC domain
PROSITE profilePS5100560.1078159IPR003441NAC domain
PfamPF023652.6E-279132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MTCDNLELPP GFRFHPTDDE LVMHYLCRKC ASQPISVPII AEIDLYKFDP WQLPEMALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGTGYWK ATGADKPIGK PKPVGIKKAL VFYAGKAPRG  120
VKTNWIMHEY RLANVDRSAG KRNNNLRLDD WVLCRIYNKK GTLEKHYVND NQSSEMEVET  180
KPKITQNTPA PGVHPPASVP HHVMNDVFHF DTSESVPTLH TDSSPEHERE VQSDPKQNDV  240
GFSYMDPFQD DGFTPQSQYY NDFSLSPLQD MFMX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-83616513174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048529.11e-134NAC domain transcriptional regulator superfamily protein
SwissprotQ390131e-119NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A103Y4L81e-175A0A103Y4L8_CYNCS; No apical meristem (NAM) protein
STRINGPOPTR_0005s07060.11e-131(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-109NAC family protein